Crestor 20mg is a medicine containing Rosuvastatin, a statin drug.
Rosuvastatin, known generically as Crestor is a widely used statin drug used to lower high cholesterol levels in individuals who are at risk for heart disease, diabetes, and stroke.
Individuals with high cholesterol or those that are at risk of heart disease should exercise caution and consider statins like Crestor.
Crestor 20mg contains 20 mg of Rosuvastatin, the active ingredient, which belongs to a class of drugs known as HMG-CoA reductase inhibitors.
Carefully read the patient information leaflet before use.
The content on this page is provided solely for informational purposes.
Crestor is a powerful statin used to lower cholesterol levels in individuals with cardiovascular disease, particularly in those at risk for heart disease and stroke.
Individuals with cholesterol levels below 25 mmol per day should use Crestor.
Crestor may also be used for purposes not listed in this medication guide.
Crestor is a statin used to lower levels of LDL (low-density lipoprotein) cholesterol, which is a culprit in the buildup of plaques in the blood vessels of the blood vessels leading to the heart.
Crestor works by blocking the enzyme responsible for breaking down cholesterol in the liver, which prevents the liver from producing enough cholesterol to meet the needs of the heart.
Crestor may also be prescribed for purposes not listed in this medication guide.
Crestor can help provide people with lowering levels of high cholesterol or preventing heart disease. It also helps reduce the risk of stroke and other cardiovascular complications in people who already have heart disease.
It is important to note that Crestor does not prevent the development of cancer or the spread of infection in individuals with a known sensitivity to Crestor.
People with a history of heart disease or other risk factors should use Crestor.
Use Crestor as directed by your doctor. It may take several weeks of taking Crestor for your body to know when to start taking it and when to start taking it.
The dosage of Crestor can vary depending on the individual and the severity of their cholesterol levels. Your doctor will determine the appropriate dosage to start with and how often to take it.
It is important to follow the dosage instructions provided by your doctor. Your doctor will determine the appropriate dosage of Crestor based on your medical history, current medications, and response to treatment.
Do not stop taking Crestor suddenly without consulting your doctor. If you stop taking it suddenly, you may experience certain side effects, such as muscle pain, nausea, and headache. Side effects can include the following:
It is important to inform your doctor of any other medications you are currently taking.
Crestor should not be used to treat cholesterol levels. It may lead to a higher risk of cardiovascular events, such as heart attacks and strokes. If you have any questions about your dosage, contact your doctor.
Like any medication, Crestor may cause side effects.
CRESTOR 10MG TABLET is used in the management of high blood cholesterol levels. It is prescribed when diet and exercise does not result in adequate results. It contains a medicine called which is an anti-hyperlipidemic agent that works by blocking cholesterol production in the body. It also makes your body eliminate lipids particles from the blood.
By reducing blood cholesterol levels, this medicine is helpful is reducing cardiovascular risks and problems in blood circulation across the body. While taking CRESTOR 10MG TABLET, you must follow a cholesterol-lowering diet, lifestyle changes and regular physical activity as instructed by your doctor to achieve better results.
Before taking CRESTOR 10MG TABLET inform your doctor if you have any lung, liver, kidney or heart problems. You must also inform your doctor if you have diabetes, thyroid problems, or a family history of muscle disorders. Do not take CRESTOR 10MG TABLET if you are pregnant or breastfeeding without consulting your doctor.
CRESTOR 10MG TABLET may increase your blood sugar levels, especially in patients who are diabetic. It may also affect the way your liver works and so your doctor will closely monitor your blood sugar levels and liver functions while undergoing therapy with CRESTOR 10MG TABLET as a precaution.
The most common side effects of taking CRESTOR 10MG TABLET are muscle ache, constipation, stomach pain, dizziness, nausea and headache. Inform your doctor if you experience severe unexplained muscle pain, tenderness or weakness along with fever after taking CRESTOR 10MG TABLET.
How should I take CRESTOR 10MG TABLET? CRESTOR 10MG TABLET should be used only when high blood lipid levels occur. Talk to your doctor regarding dosages and to ensure youmetic protection of your eye from sunlight. Before taking CRESTOR 10MG TABLET:After taking CRESTOR 10MG TABLET, you must follow a cholesterol-lowering diet, lifestyle changes and regular physical activity as instructed by your doctor to achieve better results. You must also take CRESTOR 10MG TABLET until you reach the maximum recommended dosage of 2.2 mg/kg of body weight once daily, unless advised by your doctor. Team the medicine with the counseling and dosage instructions given by your doctor.
Before taking CRESTOR 10MG TABLET, tell your doctor if you have any lung, liver, kidney or heart problems. You must also inform your doctor if you are taking CRESTOR 10MG TABLET also if you are taking it for enlarged prostate gland (benign prostatic hyperplasia).
CRESTOR 10MG TABLET may increase the blood sugar levels and so your doctor will closely monitor your blood sugar levels and liver functions while taking this medicine as it is prescribed for the treatment of hyperlipidemia as done for weight loss in adults. Inform your doctor if you have liver, kidney or heart problems. Do not exceed the recommended dose of 2.2 mg/kg of body weight once daily unless advised by your doctor.
CRESTOR 10MG TABLET may increase the blood sugar levels and so it is usually used in patients who are diabetic. However, it may also affect the way your liver works and so your doctor will closely monitor the levels of this medicine as they receive a blood test while undergoing therapy with CRESTOR 10MG TABLET as a precaution. Inform your doctor if you are taking CRESTOR 10MG TABLET if you are trying to become pregnant without consulting your doctor.
Which medicine is best for which patient? Let your doctor know if you are taking CRESTOR 10MG TABLET if you are taking it for high cholesterol levels or because you have any lung, liver, kidney or heart problems. You must also inform your doctor if you are taking CRESTOR 10MG TABLET if you are taking it for enlarged prostate gland (benign prostatic hyperplasia). Your doctor will advise you regarding a cholesterol-lowering medicine such as diet and lifestyle changes when taking CRESTOR 10MG TABLET, depending on your age, gender distribution and overall health.Some common side effects of taking CRESTOR 10MG TABLET are muscle ache, constipation, stomach pain, dizziness, nausea, and headache. They can also be severe and include eye pain, fever, anemia, pain in extremity, dark colored urine.
Atorvastatin (Crestor) is prescribed to help reduce cholesterol levels in people with coronary heart disease, stroke, high-risk prostate enlargement, or other heart conditions. It is also used to reduce high triglyceride levels in people with high cholesterol. For more information on how to give your medication a try, read the information section on this page.
It is important to know that the risk of side effects when taking this medicine is higher if you use it for more than a prescribed duration. This could lead to serious side effects, including:
Before starting or changing your medication, tell your doctor about all of the medications you are taking, including over-the-counter drugs, supplements, and herbal remedies. Tell your doctor if you have any of these conditions:
Crestor may affect certain lab results. For example, your blood cholesterol level will increase when you start taking Crestor (Crestor). Your doctor may need to adjust your dose of your medication. If you have questions about why this test result changes, talk with your doctor.
Tell your doctor if you have or have ever had liver disease. If you have liver disease, talk with your doctor before taking Crestor (Crestor) until you have discussed the risks and benefits of using it with your doctor.
The most common side effects of Crestor (Crestor) include:
This is not a complete list of side effects that may occur. Call your doctor for medical advice about side effects. You may report side effects to FDA at 1-800-FDA-1088.
FDA has approved several types of medicines to treat or prevent heart disease and high cholesterol. These include:
This is not a complete list of Crestor side effects. You may report side effects to your doctor or pharmacist when using this product. You may also contact us or call 911 or National Callback.
This page will list all of the FDA-approved drugs to treat heart disease and high cholesterol that are available under the following brand names:
Sold and Supplied by Healthylife Pharmacy
This product is a Prescription Only Medicine (S4) and is sold by Healthylife Pharmacy, an independently owned and operated pharmacy business. This prescription product requires a valid Australian script.
Medicare CardNo MedicareConcession
$22.95
Healthylife provides general product information such as nutritional information, country of origin and product packaging for your convenience. This information is intended as a guide only, including because products change from time to time. Please read product labels before consuming. For therapeutic goods, always read the label and follow the directions for use on pack. If you require specific information to assist with your purchasing decision, we recommend that you contact the manufacturer via the contact details on the packaging or email us at [email protected]. Product ratings and reviews are taken from various sources including Bazaarvoice. Healthylife does not represent or warrant the accuracy of any statements, claims or opinions made in product ratings and reviews.
Protein Supples weights*each each=30
4 Tablets
each=30
10 Tablets
20 Tablets
40 Tablets
80 Tablets
60 Tablets
120 Tablets
Save andorkwalmartpharmacyclinicpharmacy.cahealthylife.iebpharmacyclinic.iebpharmacyclinicpharmacy.iebpharmacyclinic.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinic.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.iebpharmacyclinicpharmacy.